PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24348.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 204aa    MW: 23638.6 Da    PI: 8.324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24348.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+ +++ +G g W++ a+  g++Rt+k+c++rw++yl
       KHN24348.1 16 KGPWTMEEDLILITYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 63
                     79********************************************97 PP

2Myb_DNA-binding55.71.2e-1769112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
       KHN24348.1  69 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 112
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-23966IPR009057Homeodomain-like
PROSITE profilePS5129417.0491163IPR017930Myb domain
SuperFamilySSF466891.35E-3013110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002496.6E-161663IPR001005SANT/Myb domain
CDDcd001676.07E-101863No hitNo description
PROSITE profilePS5129425.64464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2567119IPR009057Homeodomain-like
SMARTSM007171.8E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1669112IPR001005SANT/Myb domain
CDDcd001672.68E-1273112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MDKKLGNTSH DPEVRKGPWT MEEDLILITY IANHGEGVWN SLAKAAGLKR TGKSCRLRWL  60
NYLRPDVRRG NITPEEQLLI MELHAKWGNR WSKIAKHLPG RTDNEIKNYW RTRIQKHLKQ  120
ASSSFQQQSS NSEIIYHPQA CTSQVSTMAQ PIETYSPPSY QGMLDPFSIQ FPTNPHHSSC  180
CTNDDDNNNY WSMEDIWSMQ LANY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-271111822128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0904800.0BT090480.1 Soybean clone JCVI-FLGm-4H21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235865.11e-155MYB transcription factor MYB98
SwissprotP813916e-91MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0B2QX511e-154A0A0B2QX51_GLYSO; Myb-related protein 305
TrEMBLQ0PJJ51e-154Q0PJJ5_SOYBN; MYB transcription factor MYB98
STRINGGLYMA19G14230.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.13e-79myb domain protein 24
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]